PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016469438.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 453aa    MW: 51808.5 Da    PI: 8.3988
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016469438.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.21.9e-151694999
                    HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3  9 dvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                      +k++ l +pk f+ ++ +g k+e     +  +  ++W vk+  ++++    +++GW eFv++n+L+ gD++vF+++g+++f   v +f++
  XP_016469438.1 16 PGFKHA-LKIPKGFL-KYlNGRKHE---HAVLRRADKKWLVKV--NGYR----FEEGWAEFVEENDLQLGDMLVFRHEGNMKF--EVIIFDS 94
                    455555.********.554666555...56677899*******..6666....*************************99999..7777775 PP

2B347.82.6e-15197277690
                     ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                     ++++ l+ g l+lp +fa+    ++ ++ +l ++de+ r W++kl+ + +++r+++++GW++F  +n Lk+g+ ++F+++++ ++
  XP_016469438.1 197 IRPYCLTCGYLRLPQQFANGL--SN-KKCDLFIRDERQRLWNLKLS-SDCKDRVYIGDGWRKFIADNCLKVGERIMFEVVSDGKT 277
                     6788889999*******9444..33.3348***************5.777788*************************8876443 PP

3B358.51.2e-18353432587
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                     ++++++ k+ rl+l  +fa+++g+ +++  +++++de+ rsW+v+l    ++ ++ +t+GW +Fvkan++++gD++ F+l+++
  XP_016469438.1 353 TIKPYSIKRPRLYLQADFAKSNGLMNRR-CEMIITDEKQRSWSVQL--GPTGHHVAITRGWTKFVKANDVQVGDTFKFELINN 432
                     568999****************887655.59***************..****9**************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.6E-22497IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.04E-217101IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.816795IPR003340B3 DNA binding domain
CDDcd100173.03E-18893No hitNo description
SMARTSM010196.0E-151095IPR003340B3 DNA binding domain
PfamPF023626.1E-121893IPR003340B3 DNA binding domain
SuperFamilySSF1019361.39E-15189286IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.1E-16190286IPR015300DNA-binding pseudobarrel domain
SMARTSM010192.7E-9192289IPR003340B3 DNA binding domain
PROSITE profilePS5086311.984192289IPR003340B3 DNA binding domain
PfamPF023622.2E-13196278IPR003340B3 DNA binding domain
CDDcd100172.82E-12200286No hitNo description
SuperFamilySSF1019362.55E-19344441IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.9E-20344441IPR015300DNA-binding pseudobarrel domain
CDDcd100178.92E-17348442No hitNo description
PROSITE profilePS5086313.366349443IPR003340B3 DNA binding domain
SMARTSM010191.6E-14350447IPR003340B3 DNA binding domain
PfamPF023628.6E-17353432IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MKVRPVKPHF FKPIQPGFKH ALKIPKGFLK YLNGRKHEHA VLRRADKKWL VKVNGYRFEE  60
GWAEFVEEND LQLGDMLVFR HEGNMKFEVI IFDSSHCDRE YAEYLQEEEA ATPTAHTFGE  120
TSKNFEFKDT NNYASIPSGD RLYGSLPSMS CHLSHSGNTD DVIEIPSPDI NSSDEDSSHA  180
EAATDKHVGH SHFICTIRPY CLTCGYLRLP QQFANGLSNK KCDLFIRDER QRLWNLKLSS  240
DCKDRVYIGD GWRKFIADNC LKVGERIMFE VVSDGKTEST WKFHVTDAET PKQKFQDLRA  300
NASLHPEGKK PDLDANRYST QGLRIETSDM TAPKAQVPAS TSANNAYPHF ISTIKPYSIK  360
RPRLYLQADF AKSNGLMNRR CEMIITDEKQ RSWSVQLGPT GHHVAITRGW TKFVKANDVQ  420
VGDTFKFELI NNGTIPIAYF HCKYSGKDTK QSH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009597673.10.0PREDICTED: B3 domain-containing protein REM17-like isoform X1
RefseqXP_009597666.10.0PREDICTED: B3 domain-containing protein REM17-like isoform X1
RefseqXP_016469438.10.0PREDICTED: B3 domain-containing protein REM17-like isoform X1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32215171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26680.16e-34B3 family protein